accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

All Primary Antibodies (1,658,003)
Primary Antibody Matched Pairs (7,840)
Protein Interaction Antibody Pairs (962)
Protein Phosphorylation Antibody Pairs (93)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (2)
  • (865)
  • (324,173)

brands

  • (1)
  • (1)
  • (12,272)
  • (269)
  • (37)
  • (30)
  • (57)
  • (2)
  • (2)
  • (978)
  • (67,018)
  • (6)
  • (59,913)
  • (1)
  • (109)
  • (1,315)
  • (578)
  • (2)
  • (1)
  • (10)
  • (1)
  • (1)
  • (48)
  • (1)
  • (6)
  • (6)
  • (1)
  • (54)
  • (1)
  • (1)
  • (2)
  • (5)
  • (7)
  • (6)
  • (1)
  • (7,408)
  • (493)
  • (14)
  • (1)
  • (1)
  • (8)
  • (2)
  • (2)
  • (1)
  • (3)
  • (209)
  • (52)
  • (1)
  • (5)
  • (1)
  • (47)
  • (3)
  • (15)
  • (1)
  • (11)
  • (2)
  • (1)
  • (4)
  • (20)
  • (20)
  • (14,223)
  • (2)
  • (31,026)
  • (79)
  • (27)
  • (4)
  • (474)
  • (2)
  • (1)
  • (12,499)
  • (1)
  • (1)
  • (51)
  • (3,148)
  • (1)
  • (141)
  • (6)
  • (437)
  • (105)
  • (26,367)
  • (1)
  • (4,231)
  • (1)
  • (1)
  • (1)
  • (17,199)
  • (1)
  • (77)
  • (18,956)
  • (228)
  • (3)
  • (1)
  • (62)
  • (1)
  • (1)
  • (2)
  • (5)
  • (1)
  • (3)
  • (25)
  • (11)
  • (416)
  • (3)
  • (11,559)
  • (29)
  • (3)
  • (2)
  • (46)
  • (42)
  • (10,584)
  • (1)
  • (1)
  • (3)
  • (9)
  • (7)
  • (2)
  • (20)
  • (2)
  • (2)
  • (55)
  • (1)
  • (2)
  • (12)
  • (20)
  • (1)
  • (35)
  • (1)
  • (45)
  • (2)
  • (1)
  • (53)
  • (503)
  • (53)
  • (10)
  • (39)
  • (13)
  • (11)
  • (1,193)
  • (7)
  • (9)
  • (61)
  • (2)
  • (20)
  • (11)
  • (2)
  • (26)
  • (2)
  • (1)
  • (3)
  • (5)
  • (2)
  • (212)
  • (2)
  • (97)
  • (1)
  • (172)
  • (5)
  • (135)
  • (1)
  • (13)
  • (1)
  • (117)
  • (1,987)
  • (114)
  • (2,514)
  • (56)
  • (13)
  • (1)
  • (1)
  • (985)
  • (1)
  • (1)
  • (1)
  • (2)
  • (6)
  • (123)
  • (1)
  • (3)
  • (2)
  • (3)
  • (1)
  • (1)
  • (1)
  • (8)
  • (1)
  • (187)
  • (1)
  • (1,631)
  • (3)
  • (1)
  • (1)
  • (3)
  • (1)
  • (1)
  • (1)
  • (1)
  • (13)
  • (5)
  • (17)
  • (25)
  • (12)
  • (3)
  • (1)
  • (1)
  • (14)
  • (1)
  • (2)
  • (2)
  • (148)
  • (33)
  • (1)
  • (41)
  • (1)
  • (22)
  • (3)
  • (4)
  • (1)
  • (1)
  • (5)
  • (1)
  • (2)
  • (150,079)
  • (17)
  • (51)
  • (254)
  • (1)
  • (1)
  • (4)
  • (1)
  • (125)
  • (2)
  • (9)
  • (1)
  • (4)
  • (209)
  • (1,697)
  • (3)
  • (11)
  • (8)
  • (2)
  • (2)
  • (137)
  • (23)
  • (39)
  • (1)
  • (1)
  • (1)
  • (1)
  • (94)
  • (10,284)
  • (4)
  • (161)
  • (1)
  • (8)
  • (1)
  • (8,402)
  • (1)
  • (2)
  • (16)
  • (3)
  • (127)
  • (9)
  • (1)
  • (3)
  • (10)
  • (8)
  • (7)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (1)
  • (950,304)
  • (1)
  • (13)
  • (1)
  • (2)
  • (30,476)
  • (27)
  • (1)
  • (1)
  • (603)
  • (326)
  • (79)
  • (1)
  • (1)
  • (9)
  • (1)
  • (1)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (35,348)
  • (1)
  • (24)
  • (2)
  • (11)
  • (12,331)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (7)
  • (59)
  • (19)
  • (103,591)
  • (1)
  • (6)
  • (14)
  • (3)
  • (1)
  • (31)
  • (496)
  • (1)
  • (12)
  • (2,462)
  • (2)
  • (1)
  • (4)
  • (2)
  • (1)
  • (4)
  • (834)
  • (404)
  • (1)
  • (7)
  • (4)
  • (1)
  • (4)
  • (1,644)
  • (124)
  • (1)
  • (1)
  • (1)
  • (563)
  • (2)
  • (19,370)
  • (1)
  • (1)
  • (1)
  • (1,796)
  • (4)
  • (4)
  • (2)
  • (2)
  • (1)
  • (1)
  • (9)
  • (1)
  • (1)
  • (6)
  • (4)
  • (1)
  • (40)
  • (1)
  • (1)
  • (1)
  • (6)
  • (1)
  • (2)
  • (2,907)
  • (8)
  • (1)
  • (61)
  • (2)
  • (10)
  • (1)
  • (1)
  • (2)
  • (2)
  • (2)
  • (2)
  • (8)
  • (5)
  • (1)
  • (20)
  • (28)
  • (309)
  • (1)
  • (3)
  • (2)
  • (6)
  • (1)
  • (1)
  • (9)
  • (10)
  • (2)
  • (1)
  • (1)
  • (2)
  • (40)
  • (7)
  • (1)
  • (2)
  • (915)
  • (2)
  • (3)

special interests

  • (154)
  • (14,233)
  • (163,121)
  • (27)
  • (1,074,140)

Quantity

  • (1)
  • (7)
  • (2)
  • (3,051)
  • (901)
  • (1,756)
  • (4,347)
Show all

Host Species

  • (565)
  • (2,578)
  • (38)
  • (1)
  • (15)
  • (1,621)
  • (726)
Show all

Conjugate

  • (28,750)
  • (9)
  • (1)
  • (25)
  • (2,809)
  • (74)
  • (89)
Show all

Applications

  • (2)
  • (20)
  • (23)
  • (114)
  • (798)
  • (469)
  • (92)
Show all

Classification

  • (81)
  • (105)
  • (699,855)
  • (3,641)
  • (11)
  • (682,375)
  • (30,344)
Show all

Target Species

  • (24)
  • (34)
  • (129)
  • (29)
  • (5)
  • (1,425)
  • (109)
Show all

Isotype

  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (6)
Show all

Regulatory Status

  • (335)
  • (960)
  • (1,333,197)

Form

  • (2,698)
  • (2,107)
  • (1,630)
  • (14)
  • (9)
  • (21)
  • (296,861)
Show all

Research Discipline

  • (1)
  • (3)
  • (1)
  • (2)
  • (1)
  • (1)
  • (2)
Show all

Search Within Results
Keyword Search:
1,546 – 1,560 of 1,588,890 results
1,546
Promotions Available

Invitrogen™ CD186 (CXCR6) Monoclonal Antibody (DANID2), PE, eBioscience™

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate PE
Applications Flow Cytometry
Form Liquid
Gene Accession No. Q9EQ16
Isotype IgG2a κ
Concentration 0.2 mg/mL
Antigen CD186 (CXCR6)
Gene Symbols CXCR6
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias BB217514; BONZO; C Cmotif chemokine; C X C motif chemokine; CC motif chemokine; CCmotif chemokine; CD186; CD186 antigen; CDw186; chemokine (C-X-C motif) receptor 6; chemokine receptor CXCR6; CXC; C-X-C chemokine receptor type 6; CXC motif chemokine; C-X-C motif chemokine receptor 6; Cxcr6; CXC-R6; CXCR-6; G protein-coupled receptor; G-protein coupled receptor bonzo; G-protein coupled receptor STRL33; OTTHUMP00000209997; OTTHUMP00000209998; STRL33; TYMSTR
Gene CXCR6
Product Type Antibody
Gene ID (Entrez) 80901
Formulation PBS with 0.09% sodium azide; pH 7.2
Immunogen Mammalian cell line expressing the full form of CD186.
Classification Monoclonal
Primary or Secondary Primary
Clone DANID2
1,547
Promotions Available

Invitrogen™ Ghrelin Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. Q9EQX0, Q9QYH7, Q9UBU3
Isotype IgG
Concentration 1 mg/mL
Antigen Ghrelin
Gene Symbols GHRL
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias 2210006E23Rik; AMCBX1; Appetite-regulating hormone; appetite-regulating hormone; uncharacterized protein LOC58991; exon 2- and 3-deleted preproghrelin; exon 2-deleted preproghrelin; FIP3; FIP-3; Fip3p; Ghr; Ghrelin; ghrelin 27; ghrelin 28; ghrelin and obestatin prepropeptide; ghrelin precursor; ghrelin, growth hormone secretagogue receptor ligand; ghrelin/obestatin; ghrelin/obestatin preprohormone; ghrelin/obestatin prepropeptide; Ghrelin-27; Ghrelin-28; ghrelin-like protein; GHRL; Growth hormone secretagogue; growth hormone-releasing peptide; IKK-gamma; In2c-preproghrelin; IP; IP1; IP2; IPD2; m46; Motilin-related peptide; MTLRP; MTLRPAP; NEMO; Obestatin; Obestatin-13; Obestatin-23; OTTHUMP00000207794; OTTHUMP00000207795; OTTHUMP00000207796; OTTHUMP00000207798; prepro-appetite regulatory hormone; preproghrelin; proghrelin; Protein M46; UNQ524/PRO1066
Gene GHRL
Product Type Antibody
Gene ID (Entrez) 51738, 58991, 59301
Formulation PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen Synthetic peptide corresponding to residues F(1) N A P F D V G I K L S G A Q Y Q Q H G R A L(23) of the rat Obestatin gene.
Classification Polyclonal
Primary or Secondary Primary
1,548

Invitrogen™ CD8 alpha Monoclonal Antibody (C8/144B), Alexa Fluor™ Plus 488

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark
Target Species Human
Host Species Mouse
Conjugate Alexa Fluor Plus 488
Applications Immunohistochemistry (Paraffin),Multiplex Immunohistochemistry
Form Liquid
Gene Accession No. P01732, P10966
Isotype IgG1 κ
Concentration 0.2 mg/mL
Antigen CD8 alpha
Gene Symbols Cd8a, CD8B
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias BB154331; CD8; CD8 alpha; CD8 alpha chain; CD8 alpha chain precursor; CD8 antigen; CD8 antigen 32 kDa chain; CD8 antigen 37 kDa chain; CD8 antigen alpha polypeptide; CD8 antigen alpha protein; CD8 antigen alpha protein precursor; CD8 antigen alpha-chain; CD8 antigen beta polypeptide; CD8 antigen beta polypeptide precursor; CD8 antigen beta-chain; CD8 antigen, alpha chain; CD8 antigen, alpha polypeptide; CD8 antigen, alpha polypeptide (p32); CD8 antigen, alpha-chain; CD8 antigen, beta chain; CD8 antigen, beta chain 1; CD8 antigen, beta polypeptide; CD8 antigen, beta polypeptide 1 (p37); CD8 antigen, beta-chain; CD8 beta; CD8 beta chain; CD8 beta-2; CD8a; CD8A antigen alpha; CD8a molecule; CD8A; T-cell surface glycoprotein; CD8alpha; CD8B; CD8b antigen; CD8b molecule; CD8b molecule pseudogene; Cd8b1; CD8beta; CD8BP; fCD8; LEU2; Leu-2; Leu2 T-lymphocyte antigen; leu-2a; Ly-2; LY3; Ly-3; Ly-35; Ly-B; Ly-C; Lymphocyte antigen 3; Lyt2; Lyt-2; Lyt-2.1 lymphocyte differentiation antigen (AA at 100); Lyt3; Lyt-3; MAL; membrane glycoprotein; membrane protein; OKT8 T-cell antigen; OX-8 membrane antigen; p32; P37; RHACD8-4; T cell co-receptor; T lymphocyte surface glycoprotein beta chain; T8 T-cell antigen; T-cell antigen Leu2; T-cell membrane glycoprotein Ly-3; T-cell surface glycoprotein; T-cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 beta chain; T-cell surface glycoprotein Lyt-2; T-cell surface glycoprotein Lyt-3; T-cell surface molecule; T-lymphocyte differentiation antigen T8/Leu-2; type I transmembrane glycoprotein
Gene CD8B
Product Type Antibody
Gene ID (Entrez) 925, 926
Formulation PBS with 0.5% BSA, 10% proprietary stabilizer and 0.05% sodium azide; pH 7.2
Immunogen A 13 amino acid synthetic peptide from the C-terminal cytoplasmic domain of alpha chain of human CD8 molecule.
Classification Monoclonal
Primary or Secondary Primary
Clone C8/144B
1,549

Invitrogen™ CD4 Monoclonal Antibody (S3.5), Qdot™ 605
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C
Target Species Human
Host Species Mouse
Conjugate Qdot 605
Applications Flow Cytometry
Form Liquid
Gene Accession No. P01730
Isotype IgG2a
Antigen CD4
Gene Symbols CD4
Regulatory Status RUO
Purification Method Purified
Gene Alias Activation B7-1 antigen; B7; B7.1; B7-1; BB1; B-lymphocyte activation antigen B7; CD28LG; CD28LG1; CD4; CD4 antigen; CD4 antigen (p55); CD4 antigen p55; Cd4 molecule; CD4 precursor; CD4 receptor; CD4, allele 1; cd4a; CD4mut; CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); CD80 molecule; cell surface glycoprotein CD4; costimulatory factor CD80; costimulatory molecule variant IgV-CD80; CTLA-4 counter-receptor B7.1; fCD4; L3T4; LAB7; Leu-3; Ly-4; lymphocyte antigen CD4; lymphocyte antigen CD4 precursor; membrane protein; p55; T-cell differentiation antigen L3T4; T-cell surface antigen T4/Leu-3; T-cell surface glycoprotein CD4; T-cell surface glycoprotein CD4 precursor (T-cell surface antigen T4/Leu-3) (T-cell differentiation antigen L3T4); T-lymphocyte activation antigen CD80; W3/25; W3/25 antigen
Gene CD4
Product Type Antibody
Gene ID (Entrez) 920
Formulation 0.05M borate with 1M betaine and 0.05% sodium azide; pH 8.3
Immunogen Human CD4.
Classification Monoclonal
Primary or Secondary Primary
Clone S3.5
1,550
Promotions Available

Invitrogen™ CD247 (CD3 zeta) Monoclonal Antibody (6B10.2), PE, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate PE
Applications Flow Cytometry
Form Liquid
Gene Accession No. P20963
Isotype IgG1 κ
Concentration 0.2 mg/mL
Antigen CD247 (CD3 zeta)
Gene Symbols CD247
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 4930549J05Rik; A430104F18Rik; antigen CD3Z, zeta polypeptide; AW552088; Cd247; CD247 antigen; CD247 antigen, zeta subunit; Cd247 molecule; Cd3; CD3 antigen, zeta polypeptide; CD3 zeta; CD3 zeta chain; CD3e antigen; CD3-epsilon; Cd3-eta; CD3H; CD3Q; Cd3z; CD3Z antigen, zeta polypeptide (TiT3 complex); Cd3zeta; Cd3-zeta; CD3zeta chain; CD3-zeta/eta; FLJ18683; IMD25; T3E; T3z; T-cell antigen receptor complex, zeta subunit of CD3; T-cell receptor CD3 subunit zeta; T-cell receptor CD3, subunit zeta; T-cell receptor T3 eta chain; T-cell receptor T3 zeta chain; T-cell receptor zeta chain; T-cell surface glycoprotein CD3 zeta chain; TCR zeta chain; TCRE; Tcrk; TCRZ; TCRzeta
Gene CD247
Product Type Antibody
Gene ID (Entrez) 919
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone 6B10.2
1,551
Promotions Available

Invitrogen™ IFN gamma Monoclonal Antibody (XMG1.2)
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE
Content And Storage -20°C
Target Species Mouse
Host Species Rat
Conjugate Unconjugated
Applications ELISA,Immunohistochemistry (Frozen),Neutralization,Western Blot
Form Liquid
Gene Accession No. P01580
Isotype IgG1
Concentration 1.0 mg/mL
Antigen IFN gamma
Gene Symbols IFNG
Regulatory Status RUO
Purification Method Protein A
Gene Alias BoIFNG; cytokine; EGK_03901; gamma interferon; gamma interferon precursor; gamma-interferon; gamma-interferon precursor (AA -23 to 143); H-IFN-g; IFG; IFI; IFN gamma; IFN γ; Ifng; IFN-g; IFNG2; IFN-gamma; IFN-gamma precursor; IFN-y; IFNγ; Immune interferon; Interferon; interferon gamma; interferon gamma precursor; interferon gamma type 2; Interferon y; Interferon γ; interferon, gamma; interferon-gama; interferon-gamma; Interferon-gamma level; interferon-gamma precursor; Interferonγ; M-IFN-g; R-IFN-g
Gene IFNG
Product Type Antibody
Gene ID (Entrez) 15978
Formulation PBS with no preservative
Immunogen Recombinant mouse IFN gamma.
Classification Monoclonal
Primary or Secondary Primary
Clone XMG1.2
1,552
Promotions Available

Invitrogen™ BTLA Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Lyophilized
Gene Accession No. Q7TSA3, Q7Z6A9
Isotype IgG
Concentration 500 μg/mL
Antigen BTLA
Gene Symbols BTLA
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias A630002H24; B and T lymphocyte associated; B and T lymphocyte associated protein; B and T lymphocyte attenuator; B- and T-lymphocyte attenuator; B- and T-lymphocyte-associated protein; BTLA; BTLA_HUMAN; BTLA1; CD272; CD272 antigen; FLJ16065; MGC129743
Gene BTLA
Product Type Antibody
Gene ID (Entrez) 151888, 208154
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen A synthetic peptide corresponding to a sequence of human CD272/BTLA (QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL).
Classification Polyclonal
Primary or Secondary Primary
1,553
Promotions Available

Invitrogen™ CD66b Monoclonal Antibody (G10F5), PE, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate PE
Applications Flow Cytometry
Form Liquid
Gene Accession No. P31997
Isotype IgM κ
Concentration 5 μL/Test
Antigen CD66b
Gene Symbols CEACAM8
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias carcinoembryonic antigen CGM6; carcinoembryonic antigen gene family member 6; carcinoembryonic antigen related cell adhesion molecule 8; carcinoembryonic antigen-related cell adhesion molecule 8; CD66b; CD67; CD67 antigen; CEACAM8; CGM6; NCA-95; non-specific cross-reacting antigen NCA-95
Gene CEACAM8
Product Type Antibody
Gene ID (Entrez) 1088
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone G10F5
1,554
Promotions Available

CD43 Monoclonal Antibody (eBioR2/60), Biotin, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate Biotin
Applications Flow Cytometry
Form Liquid
Isotype IgM
Gene Accession No. P15702
Concentration 0.5 mg/mL
Antigen CD43
Regulatory Status RUO
Purification Method Affinity chromatography
Product Type Antibody
Gene ID (Entrez) 20737
Classification Monoclonal
Primary or Secondary Primary
Clone eBioR2/60
1,555
Promotions Available

Invitrogen™ TNF alpha Monoclonal Antibody (E10041)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage 4°C
Target Species Canine,Feline,Human,Monkey,Pig
Host Species Mouse
Conjugate Unconjugated
Applications ELISA,Western Blot
Form Lyophilized
Gene Accession No. P01375, P19101, P23563, P51742
Isotype IgG1
Concentration 0.5 mg/mL
Antigen TNF alpha
Gene Symbols Tnf
Regulatory Status RUO
Purification Method Protein G
Gene Alias APC1 protein; Cachectin; C-domain 1; C-domain 2; cTNF; DADB-70P7.1; DIF; ICD1; ICD2; Intracellular domain 1; Intracellular domain 2; N-terminal fragment; NTF; RATTNF; Tnf; TNF alpha; TNF superfamily; TNF α; TNF, macrophage-derived; TNF, monocyte-derived; TNFA; TNF-a; TNFalpha; TNF-alpha; Tnfsf1a; TNFSF2; TNFα; TNLG1F; Tumor necrosis factor; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor alpha; tumor necrosis factor alpha (cachetin); tumor necrosis factor alpha precursor; tumor necrosis factor ligand 1F; tumor necrosis factor ligand superfamily member 2; Tumor necrosis factor, membrane form; Tumor necrosis factor, soluble form; tumor necrosis factor-alpha; tumor necrosis factor-alpha precursor; tumor-necrosis factor; tumour necrosis factor
Gene Tnf
Product Type Antibody
Gene ID (Entrez) 397086, 403922, 493755, 7124
Formulation PBS with 10% trehalose and no preservative
Immunogen Recombinant human TNF alpha from Pichia pastoris.
Classification Monoclonal
Primary or Secondary Primary
Clone E10041
1,556
Promotions Available

Invitrogen™ p53R2 Monoclonal Antibody (04)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications ELISA,Western Blot
Form Liquid
Gene Accession No. Q7LG56
Isotype IgG1
Antigen p53R2
Gene Symbols Rrm2b
Regulatory Status RUO
Purification Method Protein A
Gene Alias MTDPS8A; MTDPS8B; p53-inducible ribonucleotide reductase small subunit 2 homolog; p53-inducible ribonucleotide reductase small subunit 2 short form beta; p53-inducible ribonucleotide reductase small subunit 2-like protein; p53R2; Ribonucleoside-diphosphate reductase subunit M2 B; ribonucleotide reductase M2 B (TP53 inducible); ribonucleotide reductase regulatory TP53 inducible subunit M2B; RRM2B; TP53-inducible ribonucleotide reductase M2 B
Gene Rrm2b
Product Type Antibody
Gene ID (Entrez) 50484
Formulation PBS with no preservative
Immunogen Recombinant Human RRM2B/P53R2 protein (Met1-Phe351).
Classification Monoclonal
Primary or Secondary Primary
Clone 04
1,557
Promotions Available

Ly-6A/E (Sca-1) Monoclonal Antibody (D7), PE, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate PE
Applications Flow Cytometry
Form Liquid
Isotype IgG2a κ
Gene Accession No. P05533, Q64253
Concentration 0.2 mg/mL
Antigen Ly-6A/E (Sca-1)
Gene Symbols Ly6a, Ly6e
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 9804; locus A/E; Locus AE; Ly6; Ly67; Ly6a; Ly-6A.2; Ly-6A.2/Ly-6E.1; Ly6A/E; Ly-6A/E; ly6a-e; Ly6e; Ly-6E; Ly-6E.1; lymphocyte antigen 6 complex; lymphocyte antigen 6 complex, locus A; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6A-2/6E-1; Lymphocyte antigen 6E; RIG-E; Sca1; Sca-1; Sca-2; stem cell antigen 1; Stem cell antigen 2; TAP; T-cell-activating protein; thymic shared antigen 1; Tsa1; TSA-1
Product Type Antibody
Gene ID (Entrez) 110454, 17069
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone D7
1,558
Promotions Available

CD278 (ICOS) Monoclonal Antibody (C398.4A), FITC, eBioscience™, Invitrogen™
GREENER_CHOICE

Armenian Hamster Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse,Rhesus Macaque,Rat
Host Species Armenian Hamster
Conjugate FITC
Applications Flow Cytometry
Form Liquid
Isotype IgG
Gene Accession No. Q9R1T7, Q9WVS0
Concentration 0.5 mg/mL
Antigen CD278 (ICOS)
Gene Symbols ICOS
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias Activation-inducible lymphocyte immunomediatory molecule; Ailim; CCLP; CD278; CD28 and CTLA-4-like protein; CD28-related protein 1; CRP-1; CVID1; H4; Icos; inducible costimulator; inducible T cell costimulator; inducible T cell co-stimulator; inducible T-cell costimulator; inducible T-cell co-stimulator; Ly115
Gene ICOS
Product Type Antibody
Gene ID (Entrez) 54167, 64545, 705788
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone C398.4A
1,559
Promotions Available

Ly-6G/Ly-6C Monoclonal Antibody (RB6-8C5), APC-eFluor™ 780, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate APC-eFluor 780
Applications Flow Cytometry
Form Liquid
Isotype IgG2b κ
Gene Accession No. P0CW02, P0CW03, P35461
Concentration 0.2 mg/mL
Antigen Ly-6G/Ly-6C
Gene Symbols Ly6c1, Ly6c2, Ly6g
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias AA682074; AA959465; Gr1; Gr-1; Granulocyte Marker; Ly6c; Ly-6C; Ly-6C.2; Ly6c1; Ly-6C1; Ly6c2; Ly-6C2; Ly6g; Ly-6G; ly-6G.1; lymphocyte antigen 6 complex, locus C; lymphocyte antigen 6 complex, locus C1; lymphocyte antigen 6 complex, locus C2; lymphocyte antigen 6 complex, locus G; lymphocyte antigen 6C precursor (Ly-6C); lymphocyte antigen 6C1; Lymphocyte antigen 6C2; lymphocyte antigen 6G; Lymphocyte antigen Ly-6C; lymphocyte differentiation antigen; PML; PMN
Product Type Antibody
Gene ID (Entrez) 100041546, 17067, 546644
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone RB6-8C5
1,560
Promotions Available

Invitrogen™ IFNAR1 Recombinant Rabbit Monoclonal Antibody (SR45-08)
GREENER_CHOICE

Rabbit Recombinant Monoclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P17181, P33896
Isotype IgG
Concentration 1 mg/mL
Antigen IFNAR1
Gene Symbols Ifnar1
Regulatory Status RUO
Purification Method Protein A
Gene Alias alpha-type antiviral protein; AVP; beta-type antiviral protein; CD118; CRF2-1; cytokine receptor class-II member 1; Cytokine receptor family 2 member 1; H3K1; Ifar; IFN R1; IFNalpha/beta R1; IFN-alpha/beta receptor 1; IFN-alpha/betaR; IFNalpha/betaR1; IFN-alpha/betaR1; IFN-alpha/betaRalpha; IFNalpha/beta-Ralpha; IFN-alpha-REC; IFNAR; Ifnar1; IFNBR; IFNR1; IFN-R-1; Ifrc; INF-a receptor; Infar; interferon (alpha and beta) receptor 1; interferon (alpha, beta and omega) receptor 1; interferon alpha and beta receptor subunit 1; interferon alpha/beta receptor 1; interferon receptor 1; interferon-alpha/beta receptor 1; interferon-alpha/beta receptor alpha chain; interferon-beta receptor 1; type I interferon receptor 1
Gene Ifnar1
Product Type Antibody
Gene ID (Entrez) 15975, 288264, 3454
Formulation TBS with 0.05% BSA, 40% Glycerol and 0.05% sodium azide; pH 7.4
Immunogen Synthetic peptide within Human IFNAR1 aa 508-557.
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone SR45-08